| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Flavin-dependent thymidylate synthase |
|---|
| Ligand | BDBM50351771 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_764951 (CHEMBL1827108) |
|---|
| IC50 | 6930±n/a nM |
|---|
| Citation |  Kögler, M; Vanderhoydonck, B; De Jonghe, S; Rozenski, J; Van Belle, K; Herman, J; Louat, T; Parchina, A; Sibley, C; Lescrinier, E; Herdewijn, P Synthesis and evaluation of 5-substituted 2'-deoxyuridine monophosphate analogues as inhibitors of flavin-dependent thymidylate synthase in Mycobacterium tuberculosis. J Med Chem54:4847-62 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Flavin-dependent thymidylate synthase |
|---|
| Name: | Flavin-dependent thymidylate synthase |
|---|
| Synonyms: | THYX_MYCTU | TS | TSase | Thymidylate synthase thyX | thyX |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 27593.46 |
|---|
| Organism: | Mycobacterium tuberculosis |
|---|
| Description: | ChEMBL_764951 |
|---|
| Residue: | 250 |
|---|
| Sequence: | MAETAPLRVQLIAKTDFLAPPDVPWTTDADGGPALVEFAGRACYQSWSKPNPKTATNAGY
LRHIIDVGHFSVLEHASVSFYITGISRSCTHELIRHRHFSYSQLSQRYVPEKDSRVVVPP
GMEDDADLRHILTEAADAARATYSELLAKLEAKFADQPNAILRRKQARQAARAVLPNATE
TRIVVTGNYRAWRHFIAMRASEHADVEIRRLAIECLRQLAAVAPAVFADFEVTTLADGTE
VATSPLATEA
|
|
|
|---|
| BDBM50351771 |
|---|
| n/a |
|---|
| Name | BDBM50351771 |
|---|
| Synonyms: | CHEMBL1823504 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H28N3O10PS |
|---|
| Mol. Mass. | 521.48 |
|---|
| SMILES | CCCCCCCS(=O)(=O)NCC#Cc1cn([C@H]2C[C@H](O)[C@@H](COP([O-])([O-])=O)O2)c(=O)[nH]c1=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
