| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 3-dehydroquinate dehydratase |
|---|
| Ligand | BDBM50352030 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_766423 (CHEMBL1826563) |
|---|
| Ki | 39±n/a nM |
|---|
| Citation |  Tizón, L; Otero, JM; Prazeres, VF; Llamas-Saiz, AL; Fox, GC; van Raaij, MJ; Lamb, H; Hawkins, AR; Ainsa, JA; Castedo, L; González-Bello, C A prodrug approach for improving antituberculosis activity of potent Mycobacterium tuberculosis type II dehydroquinase inhibitors. J Med Chem54:6063-84 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 3-dehydroquinate dehydratase |
|---|
| Name: | 3-dehydroquinate dehydratase |
|---|
| Synonyms: | AROQ_MYCTU | aroD | aroQ |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 15786.25 |
|---|
| Organism: | Mycobacterium tuberculosis |
|---|
| Description: | ChEMBL_766423 |
|---|
| Residue: | 147 |
|---|
| Sequence: | MSELIVNVINGPNLGRLGRREPAVYGGTTHDELVALIEREAAELGLKAVVRQSDSEAQLL
DWIHQAADAAEPVILNAGGLTHTSVALRDACAELSAPLIEVHISNVHAREEFRRHSYLSP
IATGVIVGLGIQGYLLALRYLAEHVGT
|
|
|
|---|
| BDBM50352030 |
|---|
| n/a |
|---|
| Name | BDBM50352030 |
|---|
| Synonyms: | CHEMBL1823559 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H15N3O5 |
|---|
| Mol. Mass. | 317.2967 |
|---|
| SMILES | O[C@@H]1C[C@@](O)(C=C([C@H]1O)c1cn(nn1)-c1ccccc1)C(O)=O |r,c:5| |
|---|
| Structure | 
|
|---|
Search and Browse
