Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50353847 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_769360 (CHEMBL1833366) |
---|
Ki | 140.7±n/a nM |
---|
Citation | Mésangeau, C; Amata, E; Alsharif, W; Seminerio, MJ; Robson, MJ; Matsumoto, RR; Poupaert, JH; McCurdy, CR Synthesis and pharmacological evaluation of indole-based sigma receptor ligands. Eur J Med Chem46:5154-61 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Opioid receptor | Oprs1 | SGMR1_RAT | Sigma | Sigma non-opioid intracellular receptor 1 | Sigma opioid receptor | Sigma-1 | Sigmar1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25266.54 |
Organism: | RAT |
Description: | Q9R0C9 |
Residue: | 223 |
Sequence: | MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
|
|
|
BDBM50353847 |
---|
n/a |
---|
Name | BDBM50353847 |
Synonyms: | CHEMBL1831157 | US9604926, Compound CM-360 | US9724435, Compound CM-360 |
Type | Small organic molecule |
Emp. Form. | C23H28N2O2 |
Mol. Mass. | 364.4806 |
SMILES | COc1cc2CCN(CCCCn3ccc4ccccc34)Cc2cc1OC |
Structure |
|