Reaction Details |
| Report a problem with these data |
Target | Adenosine receptor A3 |
---|
Ligand | BDBM50355157 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_772802 (CHEMBL1837541) |
---|
Ki | 11.4±n/a nM |
---|
Citation | Cheong, SL; Dolzhenko, AV; Paoletta, S; Lee, EP; Kachler, S; Federico, S; Klotz, KN; Dolzhenko, AV; Spalluto, G; Moro, S; Pastorin, G Does the combination of optimal substitutions at the C²-, N¿?¿- and N¿?¿-positions of the pyrazolo-triazolo-pyrimidine scaffold guarantee selective modulation of the human A3 adenosine receptors? Bioorg Med Chem19:6120-34 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Adenosine receptor A3 |
---|
Name: | Adenosine receptor A3 |
Synonyms: | A3 adenosine receptor (hA3) | AA3R_HUMAN | ADORA3 | Adenosine A3 receptor (A3AR) |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 36197.32 |
Organism: | Homo sapiens (Human) |
Description: | P0DMS8 |
Residue: | 318 |
Sequence: | MPNNSTALSLANVTYITMEIFIGLCAIVGNVLVICVVKLNPSLQTTTFYFIVSLALADIA
VGVLVMPLAIVVSLGITIHFYSCLFMTCLLLIFTHASIMSLLAIAVDRYLRVKLTVRYKR
VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYF
SFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGREFKTAKSLFLVLFLFA
LSWLPLSIINCIIYFNGEVPQLVLYMGILLSHANSMMNPIVYAYKIKKFKETYLLILKAC
VVCHPSDSLDTSIEKNSE
|
|
|
BDBM50355157 |
---|
n/a |
---|
Name | BDBM50355157 |
Synonyms: | CHEMBL1834698 |
Type | Small organic molecule |
Emp. Form. | C27H20ClN7O |
Mol. Mass. | 493.947 |
SMILES | Clc1ccc(cc1)-c1nc2c3cn(CCc4ccccc4)nc3nc(NC(=O)c3ccccc3)n2n1 |
Structure |
|