Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Delta-type opioid receptor |
---|
Ligand | BDBM50363339 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_801265 (CHEMBL1947328) |
---|
IC50 | 0.750000±n/a nM |
---|
Citation | Dantzman, CL; King, MM; Ernst, GE; Wang, X; McCauley, JP; Andisik, DW; Brush, K; Bui, KH; Frietze, W; Hoesch, V; Liu, J; Palmer, WE; Spear, N; Hudzik, TJ; Wesolowski, SS 4-Piperidin-4-ylidenemethyl-benzamides asd-opioid receptor agonists for CNS indications: identifying clinical candidates. Bioorg Med Chem Lett22:1174-8 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Delta-type opioid receptor |
---|
Name: | Delta-type opioid receptor |
Synonyms: | D-OR-1 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRD_HUMAN | OPRK1 | opioid receptor, delta 1 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 40382.98 |
Organism: | Homo sapiens (Human) |
Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
Residue: | 372 |
Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
BDBM50363339 |
---|
n/a |
---|
Name | BDBM50363339 |
Synonyms: | CHEMBL1946024 |
Type | Small organic molecule |
Emp. Form. | C32H36FN3O3 |
Mol. Mass. | 529.6449 |
SMILES | [#6]-[#6]-[#7](-[#6]-[#6])-[#6](=O)-c1ccc(cc1)-[#6](=[#6]-1/[#6]-[#6]-[#7](-[#6]-c2ccc(F)cc2)-[#6]-[#6]-1)\c1ccc(-[#7]-[#6](=O)-[#8]-[#6])cc1 |
Structure |
|