| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Serine protease 1 |
|---|
| Ligand | BDBM50111109 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_212195 |
|---|
| Ki | 2.9±n/a nM |
|---|
| Citation |  Lee, K; Jung, WH; Park, CW; Park, HD; Lee, SH; Kwon, OH Noncovalent tripeptidic thrombin inhibitors incorporating amidrazone, amine and amidine functions at P1. Bioorg Med Chem Lett12:1017-22 (2002) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Serine protease 1 |
|---|
| Name: | Serine protease 1 |
|---|
| Synonyms: | Beta-Trypsin | Cationic trypsin | PRSS1 | TRP1 | TRY1 | TRY1_BOVIN | TRYP1 | Trypsin | Trypsin I |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 25790.52 |
|---|
| Organism: | Bos taurus (bovine) |
|---|
| Description: | P00760 |
|---|
| Residue: | 246 |
|---|
| Sequence: | MKTFIFLALLGAAVAFPVDDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVS
AAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLN
SRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQIT
SNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIK
QTIASN
|
|
|
|---|
| BDBM50111109 |
|---|
| n/a |
|---|
| Name | BDBM50111109 |
|---|
| Synonyms: | {(R)-1-Benzhydryl-2-[(S)-2-(4-carbamimidoyl-benzylcarbamoyl)-pyrrolidin-1-yl]-2-oxo-ethyl}-phosphoramidic acid dimethyl ester; trifluoroacetate |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C30H36N5O6P |
|---|
| Mol. Mass. | 593.6116 |
|---|
| SMILES | COP([O-])([O-])(N[C@H](C(c1ccccc1)c1ccccc1)C(=O)N1CCC[C@H]1C(=O)NCc1ccc(cc1)C(N)=N)OC |
|---|
| Structure | 
|
|---|
Search and Browse
