Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Peptide deformylase |
---|
Ligand | BDBM50131331 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_154179 |
---|
IC50 | 100±n/a nM |
---|
Citation | Davies, SJ; Ayscough, AP; Beckett, RP; Clements, JM; Doel, S; Pratt, LM; Spavold, ZM; Thomas, SW; Whittaker, M Structure--activity relationships of the peptide deformylase inhibitor BB-3497: modification of the P2' and P3' side chains. Bioorg Med Chem Lett13:2715-8 (2003) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Peptide deformylase |
---|
Name: | Peptide deformylase |
Synonyms: | 3.5.1.88 | BON69_24600 | BON94_18585 | D9G11_24945 | D9G11_25760 | D9J60_20755 | FORC82_p394 | PDF | Polypeptide deformylase | SAMEA3472033_04733 | def | def_2 |
Type: | n/a |
Mol. Mass.: | 16901.39 |
Organism: | Escherichia coli |
Description: | n/a |
Residue: | 150 |
Sequence: | MSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEKGIGLAATQVDIHQRIIV
IDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFE
LEADGLLAICIGLRLGNGKYCTLRLFFNQV
|
|
|
BDBM50131331 |
---|
n/a |
---|
Name | BDBM50131331 |
Synonyms: | (S)-3-{(R)-2-[(Formyl-hydroxy-amino)-methyl]-hexanoylamino}-N,N-dimethyl-succinamic acid benzyl ester | CHEMBL94260 |
Type | Small organic molecule |
Emp. Form. | C21H31N3O6 |
Mol. Mass. | 421.4873 |
SMILES | CCCC[C@H](CN(O)C=O)C(=O)N[C@@H](CC(=O)OCc1ccccc1)C(=O)N(C)C |
Structure |
|