| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Delta-type opioid receptor |
|---|
| Ligand | BDBM50021328 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_146780 |
|---|
| Kd | 14±n/a nM |
|---|
| Citation |  Cheng, A; Uyeno, E; Polgar, W; Toll, L; Lawson, JA; DeGraw, JI; Loew, G; Camerman, A; Camerman, N N-substituent modulation of opiate agonist/antagonist activity in resolved 3-methyl-3-(m-hydroxyphenyl)piperidines. J Med Chem29:531-7 (1986) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Delta-type opioid receptor |
|---|
| Name: | Delta-type opioid receptor |
|---|
| Synonyms: | Cytochrome P450 3A4 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor | Delta-type opioid receptor (DOR) | OPIATE Delta | OPRD_RAT | Opiate Delta 1 | Opioid receptor | Opioid receptor A | Opioid receptors; mu & delta | Oprd1 | Ror-a | Voltage-gated potassium channel |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 40465.04 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Competition binding assays were using CHO-K1 cell membranes expressing the opioid receptor. |
|---|
| Residue: | 372 |
|---|
| Sequence: | MEPVPSARAELQFSLLANVSDTFPSAFPSASANASGSPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTQPRDGAVVCTLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRAPCGGQEPGSLRRPRQATARERVTAC
TPSDGPGGGAAA
|
|
|
|---|
| BDBM50021328 |
|---|
| n/a |
|---|
| Name | BDBM50021328 |
|---|
| Synonyms: | 3-Cyclopropylmethyl-11-ethyl-8-hydroxy-6-methyl-3,4,5,6-tetrahydro-2H-2,6-methano-benzo[d]azocin-1-one | CHEMBL149414 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H25NO2 |
|---|
| Mol. Mass. | 299.4073 |
|---|
| SMILES | CCC1C2N(CC3CC3)CCC1(C)c1cc(O)ccc1C2=O |TLB:1:2:20.13.19:4.10.9| |
|---|
| Structure | 
|
|---|
Search and Browse
