| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50019829 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_222077 |
|---|
| IC50 | 5±n/a nM |
|---|
| Citation |  Marastoni, M; Salvadori, S; Balboni, G; Borea, PA; Marzola, G; Tomatis, R Synthesis and activity profiles of new dermorphin-(1-4) peptide analogues. J Med Chem30:1538-42 (1987) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50019829 |
|---|
| n/a |
|---|
| Name | BDBM50019829 |
|---|
| Synonyms: | CHEMBL2372402 | N-[1-(Carbamoylmethyl-carbamoyl)-2-phenyl-ethyl]-2-[2-guanidino-3-(4-hydroxy-phenyl)-propionylamino]-4-methanesulfinyl-butyramide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H35N7O6S |
|---|
| Mol. Mass. | 573.664 |
|---|
| SMILES | [#6][S+]([#8-])[#6]-[#6]-[#6@H](-[#7]-[#6](=O)-[#6@H](-[#6]-c1ccc(-[#8])cc1)\[#7]=[#6](/[#7])-[#7])-[#6](=O)-[#7]-[#6@@H](-[#6]-c1ccccc1)-[#6](=O)-[#7]-[#6]-[#6](-[#7])=O |
|---|
| Structure | 
|
|---|
Search and Browse
