Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50017023 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_201888 |
---|
IC50 | 5400±n/a nM |
---|
Citation | Gray, NM; Cheng, BK; Mick, SJ; Lair, CM; Contreras, PC Phencyclidine-like effects of tetrahydroisoquinolines and related compounds. J Med Chem32:1242-8 (1989) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Opioid receptor | Oprs1 | SGMR1_RAT | Sigma | Sigma non-opioid intracellular receptor 1 | Sigma opioid receptor | Sigma-1 | Sigmar1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25266.54 |
Organism: | RAT |
Description: | Q9R0C9 |
Residue: | 223 |
Sequence: | MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
|
|
|
BDBM50017023 |
---|
n/a |
---|
Name | BDBM50017023 |
Synonyms: | 2-(2-Ethoxy-ethyl)-1-phenyl-1,2,3,4-tetrahydro-isoquinoline | CHEMBL21323 |
Type | Small organic molecule |
Emp. Form. | C19H23NO |
Mol. Mass. | 281.392 |
SMILES | CCOCCN1CCc2ccccc2C1c1ccccc1 |
Structure |
|