Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50010753 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_201720 |
---|
IC50 | 16±n/a nM |
---|
Citation | Scherz, MW; Fialeix, M; Fischer, JB; Reddy, NL; Server, AC; Sonders, MS; Tester, BC; Weber, E; Wong, ST; Keana, JF Synthesis and structure-activity relationships of N,N'-di-o-tolylguanidine analogues, high-affinity ligands for the haloperidol-sensitive sigma receptor. J Med Chem33:2421-9 (1990) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25124.85 |
Organism: | Homo sapiens (Human) |
Description: | Q99720 |
Residue: | 223 |
Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
BDBM50010753 |
---|
n/a |
---|
Name | BDBM50010753 |
Synonyms: | CHEMBL553074 | N-(3,5-Dimethyl-adamantan-1-yl)-N'-(2-iodo-phenyl)-guanidine; hydrochloride |
Type | Small organic molecule |
Emp. Form. | C19H26IN3 |
Mol. Mass. | 423.3343 |
SMILES | CC12CC3CC(C)(C1)CC(C3)(C2)NC(N)=Nc1ccccc1I |w:15.18,TLB:0:1:8:3.10.4,4:5:11:3.10.2,4:3:11:5.8.7,THB:6:5:11:3.10.2,2:1:8:3.10.4,2:3:8:1.11.7| |
Structure |
|