Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50009063 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_201270 |
---|
Ki | 429±n/a nM |
---|
Citation | Glennon, RA; Smith, JD; Ismaiel, AM; el-Ashmawy, M; Battaglia, G; Fischer, JB Identification and exploitation of the sigma-opiate pharmacophore. J Med Chem34:1094-8 (1991) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25124.85 |
Organism: | Homo sapiens (Human) |
Description: | Q99720 |
Residue: | 223 |
Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
BDBM50009063 |
---|
n/a |
---|
Name | BDBM50009063 |
Synonyms: | (+)3-Allyl-6,11-dimethyl-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-ol | 3-Allyl-6,11-dimethyl-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-ol | 3-Allyl-8-hydroxy-6,11-dimethyl-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocinium | CHEMBL274099 |
Type | Small organic molecule |
Emp. Form. | C17H23NO |
Mol. Mass. | 257.3706 |
SMILES | CC1C2Cc3ccc(O)cc3C1(C)CCN2CC=C |TLB:9:10:1:15.13.14,16:15:1:10.4.3| |
Structure |
|