Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50002272 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_201877 |
---|
Ki | 3±n/a nM |
---|
Citation | Gilligan, PJ; Cain, GA; Christos, TE; Cook, L; Drummond, S; Johnson, AL; Kergaye, AA; McElroy, JF; Rohrbach, KW; Schmidt, WK Novel piperidine sigma receptor ligands as potential antipsychotic drugs. J Med Chem35:4344-61 (1992) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Opioid receptor, sigma 1 | Oprs1 | SGMR1_MOUSE | Sigma 1-type opioid receptor | Sigma1-receptor | Sigma1R | Sigmar1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25246.51 |
Organism: | Mus musculus (Mouse) |
Description: | O55242 |
Residue: | 223 |
Sequence: | MPWAAGRRWAWITLILTIIAVLIQAAWLWLGTQNFVFSREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCILHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWKEGTTKSEVFYPGETVVHGPGEATALEWGPNTWMVEYGRGVIPS
TLFFALADTFFSTQDYLTLFYTLRAYARGLRLELTTYLFGQDS
|
|
|
BDBM50002272 |
---|
n/a |
---|
Name | BDBM50002272 |
Synonyms: | 1-(2-Cyclopropyl-ethyl)-4-(4-fluoro-phenoxymethyl)-piperidine; compound with but-2-enedioic acid | CHEMBL423353 |
Type | Small organic molecule |
Emp. Form. | C17H24FNO |
Mol. Mass. | 277.377 |
SMILES | Fc1ccc(OCC2CCN(CCC3CC3)CC2)cc1 |
Structure |
|