Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50002331 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_176509 |
---|
IC50 | 24±n/a nM |
---|
Citation | Yevich, JP; New, JS; Lobeck, WG; Dextraze, P; Bernstein, E; Taylor, DP; Yocca, FD; Eison, MS; Temple, DL Synthesis and biological characterization of alpha-(4-fluorophenyl)-4-(5-fluoro-2-pyrimidinyl)-1-piperazinebutanol and analogues as potential atypical antipsychotic agents. J Med Chem35:4516-25 (1993) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Opioid receptor | Oprs1 | SGMR1_RAT | Sigma | Sigma non-opioid intracellular receptor 1 | Sigma opioid receptor | Sigma-1 | Sigmar1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25266.54 |
Organism: | RAT |
Description: | Q9R0C9 |
Residue: | 223 |
Sequence: | MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
|
|
|
BDBM50002331 |
---|
n/a |
---|
Name | BDBM50002331 |
Synonyms: | 4-[4-(5-Fluoro-4-methoxy-pyrimidin-2-yl)-piperazin-1-yl]-1-(4-fluoro-phenyl)-butan-1-ol | CHEMBL141854 |
Type | Small organic molecule |
Emp. Form. | C19H24F2N4O2 |
Mol. Mass. | 378.4163 |
SMILES | COc1nc(ncc1F)N1CCN(CCCC(O)c2ccc(F)cc2)CC1 |
Structure |
|