| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50044052 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_200977 (CHEMBL802064) |
|---|
| Ki | 128±n/a nM |
|---|
| Citation |  de Costa, BR; He, XS; Dominguez, C; Cutts, J; Williams, W; Bowen, WD A new approach to the design of sigma-2-selective ligands: synthesis and evaluation of N-[2-(3,4-dichlorophenyl)ethyl]-N-methyl-2-(1- pyrrolidinyl)ethylamine-related polyamines at sigma-1 and sigma-2 receptor subtypes. J Med Chem37:314-21 (1994) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25124.85 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q99720 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
|---|
| BDBM50044052 |
|---|
| n/a |
|---|
| Name | BDBM50044052 |
|---|
| Synonyms: | CHEMBL107717 | N-[2-(3,4-Dichloro-phenyl)-ethyl]-N,N'-dimethyl-N'-(4-pyrrolidin-1-yl-butyl)-propane-1,3-diamine |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H35Cl2N3 |
|---|
| Mol. Mass. | 400.429 |
|---|
| SMILES | CN(CCCCN1CCCC1)CCCN(C)CCc1ccc(Cl)c(Cl)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
