| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Adenosine receptor A1 |
|---|
| Ligand | BDBM67935 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_29147 (CHEMBL639427) |
|---|
| Ki | 4650±n/a nM |
|---|
| Citation |  Jiang, JL; van Rhee, AM; Melman, N; Ji, XD; Jacobson, KA 6-phenyl-1,4-dihydropyridine derivatives as potent and selective A3 adenosine receptor antagonists. J Med Chem39:4667-75 (1996) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Adenosine receptor A1 |
|---|
| Name: | Adenosine receptor A1 |
|---|
| Synonyms: | AA1R_RAT | ADENOSINE A1 | ADENOSINE A1 high | ADENOSINE A1 low | Adenosine A1 receptor (A1) | Adenosine receptor | Adenosine receptors A1 | Adora1 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 36704.13 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | n/a |
|---|
| Residue: | 326 |
|---|
| Sequence: | MPPYISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKTVVT
QRRAAVAIAGCWILSLVVGLTPMFGWNNLSVVEQDWRANGSVGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPTCQKPSILIYIAIFLTHGNSAMNPIVYAFRIHKFRVTFL
KIWNDHFRCQPKPPIDEDLPEEKAED
|
|
|
|---|
| BDBM67935 |
|---|
| n/a |
|---|
| Name | BDBM67935 |
|---|
| Synonyms: | 2,6-dimethyl-4-[(E)-2-phenylethenyl]-1,4-dihydropyridine-3,5-dicarboxylic acid diethyl ester | 2,6-dimethyl-4-[(E)-styryl]-1,4-dihydropyridine-3,5-dicarboxylic acid diethyl ester | CHEMBL142868 | MLS000571350 | SMR000193435 | cid_980118 | diethyl 2,6-dimethyl-4-(2-phenylvinyl)-1,4-dihydro-3,5-pyridinedicarboxylate | diethyl 2,6-dimethyl-4-[(E)-2-phenylethenyl]-1,4-dihydropyridine-3,5-dicarboxylate |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H25NO4 |
|---|
| Mol. Mass. | 355.4275 |
|---|
| SMILES | CCOC(=O)C1C(\C=C\c2ccccc2)C(C(=O)OCC)=C(C)N=C1C |c:24,t:21| |
|---|
| Structure | 
|
|---|
Search and Browse
