Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Adenosine receptor A3 |
---|
Ligand | BDBM50455116 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_30469 (CHEMBL643130) |
---|
Ki | 54±n/a nM |
---|
Citation | Baraldi, PG; Cacciari, B; Pineda de Las Infantas, MJ; Romagnoli, R; Spalluto, G; Volpini, R; Costanzi, S; Vittori, S; Cristalli, G; Melman, N; Park, KS; Ji, XD; Jacobson, KA Synthesis and biological activity of a new series of N6-arylcarbamoyl, 2-(Ar)alkynyl-N6-arylcarbamoyl, and N6-carboxamido derivatives of adenosine-5'-N-ethyluronamide as A1 and A3 adenosine receptor agonists. J Med Chem41:3174-85 (1998) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Adenosine receptor A3 |
---|
Name: | Adenosine receptor A3 |
Synonyms: | AA3R_RAT | Adenosine A3 receptor | Adenosine receptor A2a and A3 | Adora3 |
Type: | PROTEIN |
Mol. Mass.: | 36643.73 |
Organism: | Rattus norvegicus |
Description: | ChEMBL_479910 |
Residue: | 320 |
Sequence: | MKANNTTTSALWLQITYITMEAAIGLCAVVGNMLVIWVVKLNRTLRTTTFYFIVSLALAD
IAVGVLVIPLAIAVSLEVQMHFYACLFMSCVLLVFTHASIMSLLAIAVDRYLRVKLTVRY
RTVTTQRRIWLFLGLCWLVSFLVGLTPMFGWNRKVTLELSQNSSTLSCHFRSVVGLDYMV
FFSFITWILIPLVVMCIIYLDIFYIIRNKLSQNLTGFRETRAFYGREFKTAKSLFLVLFL
FALCWLPLSIINFVSYFNVKIPEIAMCLGILLSHANSMMNPIVYACKIKKFKETYFVILR
ACRLCQTSDSLDSNLEQTTE
|
|
|
BDBM50455116 |
---|
n/a |
---|
Name | BDBM50455116 |
Synonyms: | CHEMBL2113540 |
Type | Small organic molecule |
Emp. Form. | C24H25N9O7S |
Mol. Mass. | 583.576 |
SMILES | CCNC(=O)[C@H]1O[C@H]([C@H](O)[C@@H]1O)n1cnc2c(NC(=O)Nc3ccc(NS(=O)(=O)c4ccccn4)cc3)ncnc12 |r| |
Structure |
|