Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Adenosine receptor A1 |
---|
Ligand | BDBM50179047 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_29153 (CHEMBL639433) |
---|
Ki | 247±n/a nM |
---|
Citation | Baraldi, PG; Cacciari, B; Pineda de Las Infantas, MJ; Romagnoli, R; Spalluto, G; Volpini, R; Costanzi, S; Vittori, S; Cristalli, G; Melman, N; Park, KS; Ji, XD; Jacobson, KA Synthesis and biological activity of a new series of N6-arylcarbamoyl, 2-(Ar)alkynyl-N6-arylcarbamoyl, and N6-carboxamido derivatives of adenosine-5'-N-ethyluronamide as A1 and A3 adenosine receptor agonists. J Med Chem41:3174-85 (1998) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Adenosine receptor A1 |
---|
Name: | Adenosine receptor A1 |
Synonyms: | AA1R_RAT | ADENOSINE A1 | ADENOSINE A1 high | ADENOSINE A1 low | Adenosine A1 receptor (A1) | Adenosine receptor | Adenosine receptors A1 | Adora1 |
Type: | Protein |
Mol. Mass.: | 36704.13 |
Organism: | Rattus norvegicus (rat) |
Description: | n/a |
Residue: | 326 |
Sequence: | MPPYISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKTVVT
QRRAAVAIAGCWILSLVVGLTPMFGWNNLSVVEQDWRANGSVGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPTCQKPSILIYIAIFLTHGNSAMNPIVYAFRIHKFRVTFL
KIWNDHFRCQPKPPIDEDLPEEKAED
|
|
|
BDBM50179047 |
---|
n/a |
---|
Name | BDBM50179047 |
Synonyms: | 1-(9-((2R,3R,4S,5S)-5-(ethylcarbamoyl)-3,4-dihydroxy-tetrahydrofuran-2-yl)-9H-purin-6-yl)-3-(4-propoxyphenyl)urea | CHEMBL206807 |
Type | Small organic molecule |
Emp. Form. | C22H27N7O6 |
Mol. Mass. | 485.4931 |
SMILES | CCCOc1ccc(NC(=O)Nc2ncnc3n(cnc23)[C@@H]2O[C@@H]([C@@H](O)[C@H]2O)C(=O)NCC)cc1 |
Structure |
|