Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Tumor necrosis factor |
---|
Ligand | BDBM50081314 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_212403 (CHEMBL816155) |
---|
IC50 | 10000±n/a nM |
---|
Citation | Chao, Q; Deng, L; Shih, H; Leoni, LM; Genini, D; Carson, DA; Cottam, HB Substituted isoquinolines and quinazolines as potential antiinflammatory agents. Synthesis and biological evaluation of inhibitors of tumor necrosis factor alpha. J Med Chem42:3860-73 (1999) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Tumor necrosis factor |
---|
Name: | Tumor necrosis factor |
Synonyms: | Cachectin | TNF | TNF-a | TNF-alpha | TNFA | TNFA_HUMAN | TNFSF2 | Tumor necrosis factor (TNF-alpha) | Tumor necrosis factor (TNFa) | Tumor necrosis factor alpha (TNFα) | Tumor necrosis factor ligand superfamily member 2 | Tumor necrosis factor, membrane form | Tumor necrosis factor, soluble form | tumor necrosis factor alpha |
Type: | Enzyme |
Mol. Mass.: | 25645.11 |
Organism: | Homo sapiens (Human) |
Description: | P01375 |
Residue: | 233 |
Sequence: | MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQR
EEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELR
DNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRE
TPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
|
|
|
BDBM50081314 |
---|
n/a |
---|
Name | BDBM50081314 |
Synonyms: | 4-(6-Amino-4-oxo-1,4-dihydro-2H-quinazolin-3-yl)-butyric acid ethyl ester | CHEMBL126353 |
Type | Small organic molecule |
Emp. Form. | C14H19N3O3 |
Mol. Mass. | 277.319 |
SMILES | CCOC(=O)CCCN1CNc2ccc(N)cc2C1=O |
Structure |
|