| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50076496 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_145140 (CHEMBL755285) |
|---|
| Ki | >1250±n/a nM |
|---|
| Citation |  Coop, A; Rothman, RB; Dersch, C; Partilla, J; Porreca, F; Davis, P; Jacobson, AE; Rice, KC delta Opioid affinity and selectivity of 4-hydroxy-3-methoxyindolomorphinan analogues related to naltrindole. J Med Chem42:1673-9 (1999) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50076496 |
|---|
| n/a |
|---|
| Name | BDBM50076496 |
|---|
| Synonyms: | 17-cyclopropylmethyl-6,7-didehydro-4-hydroxy-3-methoxy-6,7:2',3'-indolmorphinan | CHEMBL296230 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H30N2O2 |
|---|
| Mol. Mass. | 414.5393 |
|---|
| SMILES | COc1ccc2C[C@@H]3[C@@H]4Cc5c(C[C@]4(CCN3CC3CC3)c2c1O)[nH]c1ccccc51 |
|---|
| Structure | 
|
|---|
Search and Browse
