| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM50100260 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_53135 (CHEMBL665856) |
|---|
| IC50 | 12000±n/a nM |
|---|
| Citation |  Gangjee, A; Vidwans, A; Elzein, E; McGuire, JJ; Queener, SF; Kisliuk, RL Synthesis, antifolate, and antitumor activities of classical and nonclassical 2-amino-4-oxo-5-substituted-pyrrolo[2,3-d]pyrimidines. J Med Chem44:1993-2003 (2001) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | DYR_PNECA | Dihydrofolate Reductase (DHFR) | Dihydrofolate reductase | Dihydrofolate reductase; P. carinii vs rat | Tetrahydrofolate dehydrogenase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 23891.29 |
|---|
| Organism: | Pneumocystis carinii |
|---|
| Description: | n/a |
|---|
| Residue: | 206 |
|---|
| Sequence: | MNQQKSLTLIVALTTSYGIGRSNSLPWKLKKEISYFKRVTSFVPTFDSFESMNVVLMGRK
TWESIPLQFRPLKGRINVVITRNESLDLGNGIHSAKSLDHALELLYRTYGSESSVQINRI
FVIGGAQLYKAAMDHPKLDRIMATIIYKDIHCDVFFPLKFRDKEWSSVWKKEKHSDLESW
VGTKVPHGKINEDGFDYEFEMWTRDL
|
|
|
|---|
| BDBM50100260 |
|---|
| n/a |
|---|
| Name | BDBM50100260 |
|---|
| Synonyms: | CHEMBL293258 | Phosphoric acid mono-[3-hydroxy-5-(5-methyl-2,4-dioxo-3,4-dihydro-2H-pyrimidin-1-yl)-tetrahydro-furan-2-yl] ester |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C9H13N2O8P |
|---|
| Mol. Mass. | 308.1819 |
|---|
| SMILES | Cc1cn(C2CC(O)C(OP(O)(O)=O)O2)c(=O)[nH]c1=O |
|---|
| Structure | 
|
|---|
Search and Browse
