Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM50101459 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_159290 (CHEMBL766055) |
---|
IC50 | 14±n/a nM |
---|
Citation | Hagen, SE; Domagala, J; Gajda, C; Lovdahl, M; Tait, BD; Wise, E; Holler, T; Hupe, D; Nouhan, C; Urumov, A; Zeikus, G; Zeikus, E; Lunney, EA; Pavlovsky, A; Gracheck, SJ; Saunders, J; VanderRoest, S; Brodfuehrer, J 4-Hydroxy-5,6-dihydropyrones as inhibitors of HIV protease: the effect of heterocyclic substituents at C-6 on antiviral potency and pharmacokinetic parameters. J Med Chem44:2319-32 (2001) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50101459 |
---|
n/a |
---|
Name | BDBM50101459 |
Synonyms: | 3-(2-tert-Butyl-4-hydroxymethyl-5-methyl-phenylsulfanyl)-4-hydroxy-6-[2-(2-hydroxymethyl-thiophen-3-yl)-ethyl]-6-isopropyl-5,6-dihydro-pyran-2-one | CHEMBL308167 |
Type | Small organic molecule |
Emp. Form. | C27H36O5S2 |
Mol. Mass. | 504.702 |
SMILES | CC(C)C1(CCc2ccsc2CO)CC(=O)C(Sc2cc(C)c(CO)cc2C(C)(C)C)C(=O)O1 |
Structure |
|