Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50120480 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_201584 (CHEMBL809861) |
---|
Ki | 3900±n/a nM |
---|
Citation | Maier, CA; Wünsch, B Novel sigma receptor ligands. Part 2. SAR of spiro[[2]benzopyran-1,4'-piperidines] and spiro[[2]benzofuran-1,4'-piperidines] with carbon substituents in position 3. J Med Chem45:4923-30 (2002) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Opioid receptor | Oprs1 | SGMR1_RAT | Sigma | Sigma non-opioid intracellular receptor 1 | Sigma opioid receptor | Sigma-1 | Sigmar1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25266.54 |
Organism: | RAT |
Description: | Q9R0C9 |
Residue: | 223 |
Sequence: | MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
|
|
|
BDBM50120480 |
---|
n/a |
---|
Name | BDBM50120480 |
Synonyms: | 1'-benzyl-3-ethylspiro[3,4-dihydro-1H-isochromene-1,4'-(hexahydropyridine)] | CHEMBL147093 |
Type | Small organic molecule |
Emp. Form. | C22H27NO |
Mol. Mass. | 321.4559 |
SMILES | CCC1Cc2ccccc2C2(CCN(Cc3ccccc3)CC2)O1 |
Structure |
|