| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50107088 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_201910 (CHEMBL808200) |
|---|
| Ki | 138±n/a nM |
|---|
| Citation |  Cao, J; Kulkarni, SS; Husbands, SM; Bowen, WD; Williams, W; Kopajtic, T; Katz, JL; George, C; Newman, AH Dual probes for the dopamine transporter and sigma1 receptors: novel piperazinyl alkyl-bis(4'-fluorophenyl)amine analogues as potential cocaine-abuse therapeutic agents. J Med Chem46:2589-98 (2003) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25124.85 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q99720 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
|---|
| BDBM50107088 |
|---|
| n/a |
|---|
| Name | BDBM50107088 |
|---|
| Synonyms: | CHEMBL314433 | [3-((3R,5R)-3,5-Dimethyl-piperazin-1-yl)-propyl]-diphenyl-amine | [3-(3,5-Dimethyl-piperazin-1-yl)-propyl]-diphenyl-amine |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H29N3 |
|---|
| Mol. Mass. | 323.4751 |
|---|
| SMILES | C[C@@H]1CN(CCCN(c2ccccc2)c2ccccc2)C[C@@H](C)N1 |
|---|
| Structure | 
|
|---|
Search and Browse
