Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50107093 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_201910 (CHEMBL808200) |
---|
Ki | 29.6±n/a nM |
---|
Citation | Cao, J; Kulkarni, SS; Husbands, SM; Bowen, WD; Williams, W; Kopajtic, T; Katz, JL; George, C; Newman, AH Dual probes for the dopamine transporter and sigma1 receptors: novel piperazinyl alkyl-bis(4'-fluorophenyl)amine analogues as potential cocaine-abuse therapeutic agents. J Med Chem46:2589-98 (2003) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25124.85 |
Organism: | Homo sapiens (Human) |
Description: | Q99720 |
Residue: | 223 |
Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
BDBM50107093 |
---|
n/a |
---|
Name | BDBM50107093 |
Synonyms: | (3-{(3R,5R)-4-[2-(3,4-Dichloro-phenyl)-ethyl]-3,5-dimethyl-piperazin-1-yl}-propyl)-diphenyl-amine | (3-{4-[2-(3,4-Dichloro-phenyl)-ethyl]-3,5-dimethyl-piperazin-1-yl}-propyl)-diphenyl-amine | CHEMBL84971 |
Type | Small organic molecule |
Emp. Form. | C29H35Cl2N3 |
Mol. Mass. | 496.514 |
SMILES | C[C@@H]1CN(CCCN(c2ccccc2)c2ccccc2)C[C@@H](C)N1CCc1ccc(Cl)c(Cl)c1 |
Structure |
|