| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Adenosine receptor A1 |
|---|
| Ligand | BDBM22111 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_28670 (CHEMBL649068) |
|---|
| IC50 | 15100±n/a nM |
|---|
| Citation |  Kehraus, S; Gorzalka, S; Hallmen, C; Iqbal, J; Müller, CE; Wright, AD; Wiese, M; König, GM Novel amino acid derived natural products from the ascidian Atriolum robustum: identification and pharmacological characterization of a unique adenosine derivative. J Med Chem47:2243-55 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Adenosine receptor A1 |
|---|
| Name: | Adenosine receptor A1 |
|---|
| Synonyms: | AA1R_RAT | ADENOSINE A1 | ADENOSINE A1 high | ADENOSINE A1 low | Adenosine A1 receptor (A1) | Adenosine receptor | Adenosine receptors A1 | Adora1 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 36704.13 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | n/a |
|---|
| Residue: | 326 |
|---|
| Sequence: | MPPYISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKTVVT
QRRAAVAIAGCWILSLVVGLTPMFGWNNLSVVEQDWRANGSVGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPTCQKPSILIYIAIFLTHGNSAMNPIVYAFRIHKFRVTFL
KIWNDHFRCQPKPPIDEDLPEEKAED
|
|
|
|---|
| BDBM22111 |
|---|
| n/a |
|---|
| Name | BDBM22111 |
|---|
| Synonyms: | (2R,3R,4S,5S)-2-(6-amino-9H-purin-9-yl)-5-[(methylsulfanyl)methyl]oxolane-3,4-diol | (2R,3R,4S,5S)-2-(6-aminopurin-9-yl)-5-(methylsulfanylmethyl)oxolane-3,4-diol | 5'-Methylthioado | 5-methylthioadenosine | CHEMBL277041 | MTA |
|---|
| Type | Nucleoside or nucleotide |
|---|
| Emp. Form. | C11H15N5O3S |
|---|
| Mol. Mass. | 297.334 |
|---|
| SMILES | CSC[C@H]1O[C@H]([C@H](O)[C@@H]1O)n1cnc2c(N)ncnc12 |
|---|
| Structure | 
|
|---|
Search and Browse
