| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Carbonic anhydrase |
|---|
| Ligand | BDBM26983 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_303052 (CHEMBL828021) |
|---|
| Ki | 520000±n/a nM |
|---|
| Citation |  Innocenti, A; Zimmerman, S; Ferry, JG; Scozzafava, A; Supuran, CT Carbonic anhydrase inhibitors. Inhibition of the beta-class enzyme from the methanoarchaeon Methanobacterium thermoautotrophicum (Cab) with anions. Bioorg Med Chem Lett14:4563-7 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Carbonic anhydrase |
|---|
| Name: | Carbonic anhydrase |
|---|
| Synonyms: | n/a |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 19556.84 |
|---|
| Organism: | Methanobacterium thermoautotrophicum |
|---|
| Description: | ChEMBL_1280426 |
|---|
| Residue: | 176 |
|---|
| Sequence: | MRFVSMIIKDILRENQDFRFRDLSDLKHSPKLCIITCMDSRLIDLLERALGIGRGDAKVI
KNAGNIVDDGVIRSAAVAIYALGVNEIIIVGHTDCGMARLDEDLIVSRMRELGVEEEVIE
NFSIDVLNPVGDEEENVIEGVKRLKSSPLIPESIGVHGLIIDINTGRLKPLYLDED
|
|
|
|---|
| BDBM26983 |
|---|
| n/a |
|---|
| Name | BDBM26983 |
|---|
| Synonyms: | CHEMBL1644028 | SCN(-1) | Thiocyanate | cyanosulfanide | sodium thiocyanate |
|---|
| Type | Ion |
|---|
| Emp. Form. | CNS |
|---|
| Mol. Mass. | 58.083 |
|---|
| SMILES | [N-]=C=S |
|---|
| Structure | 
|
|---|
Search and Browse
