Reaction Details |
| Report a problem with these data |
Target | Peptide deformylase |
---|
Ligand | BDBM50201881 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_423229 (CHEMBL913367) |
---|
IC50 | 50±n/a nM |
---|
Citation | Boularot, A; Giglione, C; Petit, S; Duroc, Y; Alves de Sousa, R; Larue, V; Cresteil, T; Dardel, F; Artaud, I; Meinnel, T Discovery and refinement of a new structural class of potent peptide deformylase inhibitors. J Med Chem50:10-20 (2007) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Peptide deformylase |
---|
Name: | Peptide deformylase |
Synonyms: | 3.5.1.88 | BON69_24600 | BON94_18585 | D9G11_24945 | D9G11_25760 | D9J60_20755 | FORC82_p394 | PDF | Polypeptide deformylase | SAMEA3472033_04733 | def | def_2 |
Type: | n/a |
Mol. Mass.: | 16901.39 |
Organism: | Escherichia coli |
Description: | n/a |
Residue: | 150 |
Sequence: | MSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEKGIGLAATQVDIHQRIIV
IDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFE
LEADGLLAICIGLRLGNGKYCTLRLFFNQV
|
|
|
BDBM50201881 |
---|
n/a |
---|
Name | BDBM50201881 |
Synonyms: | (1-hydroxycarbamoylmethyl-2-phenylethyl)carbamic acidtert-butyl ester | CHEMBL220470 |
Type | Small organic molecule |
Emp. Form. | C15H22N2O4 |
Mol. Mass. | 294.3462 |
SMILES | CC(C)(C)OC(=O)NC(CN(O)C=O)Cc1ccccc1 |
Structure |
|