| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Adenosine receptor A3 |
|---|
| Ligand | BDBM50238959 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_479706 (CHEMBL933570) |
|---|
| Ki | 476±n/a nM |
|---|
| Citation |  Gillespie, RJ; Cliffe, IA; Dawson, CE; Dourish, CT; Gaur, S; Giles, PR; Jordan, AM; Knight, AR; Lawrence, A; Lerpiniere, J; Misra, A; Pratt, RM; Todd, RS; Upton, R; Weiss, SM; Williamson, DS Antagonists of the human adenosine A2A receptor. Part 2: Design and synthesis of 4-arylthieno[3,2-d]pyrimidine derivatives. Bioorg Med Chem Lett18:2920-3 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Adenosine receptor A3 |
|---|
| Name: | Adenosine receptor A3 |
|---|
| Synonyms: | A3 adenosine receptor (hA3) | AA3R_HUMAN | ADORA3 | Adenosine A3 receptor (A3AR) |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 36197.32 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P0DMS8 |
|---|
| Residue: | 318 |
|---|
| Sequence: | MPNNSTALSLANVTYITMEIFIGLCAIVGNVLVICVVKLNPSLQTTTFYFIVSLALADIA
VGVLVMPLAIVVSLGITIHFYSCLFMTCLLLIFTHASIMSLLAIAVDRYLRVKLTVRYKR
VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYF
SFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGREFKTAKSLFLVLFLFA
LSWLPLSIINCIIYFNGEVPQLVLYMGILLSHANSMMNPIVYAYKIKKFKETYLLILKAC
VVCHPSDSLDTSIEKNSE
|
|
|
|---|
| BDBM50238959 |
|---|
| n/a |
|---|
| Name | BDBM50238959 |
|---|
| Synonyms: | 2-isopropyl-4-(thiazol-2-yl)thieno[3,2-d]pyrimidine | CHEMBL407307 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C12H11N3S2 |
|---|
| Mol. Mass. | 261.366 |
|---|
| SMILES | CC(C)c1nc(-c2nccs2)c2sccc2n1 |
|---|
| Structure | 
|
|---|
Search and Browse
