| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Carbonic anhydrase |
|---|
| Ligand | BDBM4703 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_515851 (CHEMBL993110) |
|---|
| Ki | 14500±n/a nM |
|---|
| Citation |  Isik, S; Kockar, F; Aydin, M; Arslan, O; Guler, OO; Innocenti, A; Scozzafava, A; Supuran, CT Carbonic anhydrase inhibitors: inhibition of the beta-class enzyme from the yeast Saccharomyces cerevisiae with sulfonamides and sulfamates. Bioorg Med Chem17:1158-63 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Carbonic anhydrase |
|---|
| Name: | Carbonic anhydrase |
|---|
| Synonyms: | CAN_YEAST | NCE103 | NCE3 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 24861.97 |
|---|
| Organism: | Saccharomyces cerevisiae |
|---|
| Description: | ChEMBL_1507033 |
|---|
| Residue: | 221 |
|---|
| Sequence: | MSATESSSIFTLSHNSNLQDILAANAKWASQMNNIQPTLFPDHNAKGQSPHTLFIGCSDS
RYNENCLGVLPGEVFTWKNVANICHSEDLTLKATLEFAIICLKVNKVIICGHTDCGGIKT
CLTNQREALPKVNCSHLYKYLDDIDTMYHEESQNLIHLKTQREKSHYLSHCNVKRQFNRI
IENPTVQTAVQNGELQVYGLLYNVEDGLLQTVSTYTKVTPK
|
|
|
|---|
| BDBM4703 |
|---|
| n/a |
|---|
| Name | BDBM4703 |
|---|
| Synonyms: | 4-carboxybenzenesulfonamide 1 | 4-sulfamoylbenzoic acid | Benzoic Acid deriv. 31 | CHEMBL414 | JMC522226 Compound 22 | JMC523116 Compound 22 | JMC52646 Compound 23 | aromatic/heteroaromatic sulfonamide 23 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C7H7NO4S |
|---|
| Mol. Mass. | 201.2 |
|---|
| SMILES | NS(=O)(=O)c1ccc(cc1)C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
