| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Carbonic anhydrase |
|---|
| Ligand | BDBM26996 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_584597 (CHEMBL1059098) |
|---|
| Ki | 100000±n/a nM |
|---|
| Citation |  Innocenti, A; Leewattanapasuk, W; Mühlschlegel, FA; Mastrolorenzo, A; Supuran, CT Carbonic anhydrase inhibitors. Inhibition of the beta-class enzyme from the pathogenic yeast Candida glabrata with anions. Bioorg Med Chem Lett19:4802-5 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Carbonic anhydrase |
|---|
| Name: | Carbonic anhydrase |
|---|
| Synonyms: | n/a |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 24709.64 |
|---|
| Organism: | Candida glabrata |
|---|
| Description: | ChEMBL_584597 |
|---|
| Residue: | 219 |
|---|
| Sequence: | MTKDTIFTLTGKCALDNILDANRQWAQAMHRSQPQLFPTNGQGQDPHTLFIGCSDSRYNE
DCLGVLPGEIFTLKTVANICHTDDHSLLATLEFAILNLKVNRIILCGHTDCGGIKTCLLG
RESIKESCPHLYEHLDDIEDLVESHESELNQLDNICSKSKLMSHRNVERQLQRLLQIPVV
QDALRNSNQDHEFNIFGLVYNVDSGLVDVVREVYGNQQK
|
|
|
|---|
| BDBM26996 |
|---|
| n/a |
|---|
| Name | BDBM26996 |
|---|
| Synonyms: | CHEMBL21485 | PhB(OH)2 | Phenyl-boronic acid | Phenylboronic acid, 22 | benzeneboronic acid | phenylboranediol | phenylboronic acid |
|---|
| Type | n/a |
|---|
| Emp. Form. | C6H7BO2 |
|---|
| Mol. Mass. | 121.93 |
|---|
| SMILES | OB(O)c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
