Reaction Details |
| Report a problem with these data |
Target | Delta-type opioid receptor |
---|
Ligand | BDBM50000296 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_662214 (CHEMBL1252205) |
---|
Ki | >5000±n/a nM |
---|
Citation | Pasquinucci, L; Prezzavento, O; Marrazzo, A; Amata, E; Ronsisvalle, S; Georgoussi, Z; Fourla, DD; Scoto, GM; Parenti, C; Aricò, G; Ronsisvalle, G Evaluation of N-substitution in 6,7-benzomorphan compounds. Bioorg Med Chem18:4975-82 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Delta-type opioid receptor |
---|
Name: | Delta-type opioid receptor |
Synonyms: | Cytochrome P450 3A4 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor | Delta-type opioid receptor (DOR) | OPIATE Delta | OPRD_RAT | Opiate Delta 1 | Opioid receptor | Opioid receptor A | Opioid receptors; mu & delta | Oprd1 | Ror-a | Voltage-gated potassium channel |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 40465.04 |
Organism: | Rattus norvegicus (rat) |
Description: | Competition binding assays were using CHO-K1 cell membranes expressing the opioid receptor. |
Residue: | 372 |
Sequence: | MEPVPSARAELQFSLLANVSDTFPSAFPSASANASGSPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTQPRDGAVVCTLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRAPCGGQEPGSLRRPRQATARERVTAC
TPSDGPGGGAAA
|
|
|
BDBM50000296 |
---|
n/a |
---|
Name | BDBM50000296 |
Synonyms: | CHEMBL441765 | CHEMBL482811 | U-50488H | US11492374, ID 1 | US11912716, Compound U50488 |
Type | Small organic molecule |
Emp. Form. | C19H26Cl2N2O |
Mol. Mass. | 369.329 |
SMILES | CN([C@@H]1CCCC[C@H]1N1CCCC1)C(=O)Cc1ccc(Cl)c(Cl)c1 |r| |
Structure |
|