Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | P2Y purinoceptor 12 |
---|
Ligand | BDBM50029031 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_718672 (CHEMBL1680823) |
---|
Ki | 680±n/a nM |
---|
Citation | Baqi, Y; Hausmann, R; Rosefort, C; Rettinger, J; Schmalzing, G; Müller, CE Discovery of potent competitive antagonists and positive modulators of the P2X2 receptor. J Med Chem54:817-30 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
P2Y purinoceptor 12 |
---|
Name: | P2Y purinoceptor 12 |
Synonyms: | ADP-glucose receptor | ADPG-R | HORK3 | P2RY12 | P2T(AC) | P2Y purinoceptor 12 | P2Y(AC) | P2Y(ADP) | P2Y(cyc) | P2Y12 | P2Y12 platelet ADP receptor | P2Y12_HUMAN | Purinergic receptor P2Y12 | SP1999 |
Type: | Enzyme |
Mol. Mass.: | 39458.48 |
Organism: | Homo sapiens (Human) |
Description: | Q9H244 |
Residue: | 342 |
Sequence: | MQAVDNLTSAPGNTSLCTRDYKITQVLFPLLYTVLFFVGLITNGLAMRIFFQIRSKSNFI
IFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITI
DRYQKTTRPFKTSNPKNLLGAKILSVVIWAFMFLLSLPNMILTNRQPRDKNVKKCSFLKS
EFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTRGVGKVPRKKVNVKVFI
IIAVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFF
LCKSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM
|
|
|
BDBM50029031 |
---|
n/a |
---|
Name | BDBM50029031 |
Synonyms: | 1-Amino-4-{4-[4-chloro-6-(3-sulfo-phenylamino)-[1,3,5]triazin-2-ylamino]-3-sulfo-phenylamino}-9,10-dioxo-9,10-dihydro-anthracene-2-sulfonic acid1-Amino-4-{4-[4-chloro-6-(4-sulfo-phenylamino)-[1,3,5]triazin-2-ylamino]-3-sulfo-phenylamino}-9,10-dioxo-9,10-dihydro-anthracene-2-sulfonic acid | CHEMBL223344 | CID44285648 | basilen blue | cibacron blue (mixer, meta and para isomers |
Type | Small organic molecule |
Emp. Form. | C29H17ClN7O11S3 |
Mol. Mass. | 771.135 |
SMILES | Nc1c(cc(Nc2ccc(Nc3nc(Cl)nc(Nc4cccc(c4)S([O-])(=O)=O)n3)c(c2)S([O-])(=O)=O)c2C(=O)c3ccccc3C(=O)c12)S([O-])(=O)=O |
Structure |
|