Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50353613 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_769558 (CHEMBL1833395) |
---|
Ki | 8±n/a nM |
---|
Citation | Schläger, T; Schepmann, D; Lehmkuhl, K; Holenz, J; Vela, JM; Buschmann, H; Wünsch, B Combination of two pharmacophoric systems: synthesis and pharmacological evaluation of spirocyclic pyranopyrazoles with highs1 receptor affinity. J Med Chem54:6704-13 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | OPRS1 | SGMR1_CAVPO | SIGMAR1 | Sigma 1-type opioid receptor | Sigma non-opioid intracellular receptor 1 | Sigma-1 receptor | Sigma1-receptor | Sigma1R | Sterol isomerase-like protein |
Type: | Protein |
Mol. Mass.: | 25307.17 |
Organism: | Cavia porcellus (Guinea pig) |
Description: | Q60492 |
Residue: | 223 |
Sequence: | MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSK
LIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP
|
|
|
BDBM50353613 |
---|
n/a |
---|
Name | BDBM50353613 |
Synonyms: | CHEMBL1829577 |
Type | Small organic molecule |
Emp. Form. | C21H29N3O2 |
Mol. Mass. | 355.4739 |
SMILES | CCCCN1CCC2(CC1)OC(Cc1c2cnn1-c1ccccc1)OC |
Structure |
|