Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Growth hormone secretagogue receptor type 1 |
---|
Ligand | BDBM50386953 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_827492 (CHEMBL2051349) |
---|
Ki | 17±n/a nM |
---|
Citation | Kung, DW; Coffey, SB; Jones, RM; Cabral, S; Jiao, W; Fichtner, M; Carpino, PA; Rose, CR; Hank, RF; Lopaze, MG; Swartz, R; Chen, HT; Hendsch, Z; Posner, B; Wielis, CF; Manning, B; Dubins, J; Stock, IA; Varma, S; Campbell, M; DeBartola, D; Kosa-Maines, R; Steyn, SJ; McClure, KF Identification of spirocyclic piperidine-azetidine inverse agonists of the ghrelin receptor. Bioorg Med Chem Lett22:4281-7 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Growth hormone secretagogue receptor type 1 |
---|
Name: | Growth hormone secretagogue receptor type 1 |
Synonyms: | GH-releasing peptide receptor | GHRP | GHS-R | GHSR | GHSR_HUMAN | Ghrelin Receptor (Growth Hormone Secretagogue Receptor Type 1) | Ghrelin receptor | Ghrelin receptor 1a (GHS-R1a) |
Type: | Receptor |
Mol. Mass.: | 41334.57 |
Organism: | Homo sapiens (Human) |
Description: | Receptor binding studies use plasma membranes from LLC PK-1 cells transiently transfected with hGHSR1a. |
Residue: | 366 |
Sequence: | MWNATPSEEPGFNLTLADLDWDASPGNDSLGDELLQLFPAPLLAGVTATCVALFVVGIAG
NLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDLLCKLFQ
FVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVIFVIWAVAFCSAGPIFV
LVGVEHENGTDPWDTNECRPTEFAVRSGLLTVMVWVSSIFFFLPVFCLTVLYSLIGRKLW
RRRRGDAVVGASLRDQNHKQTVKMLAVVVFAFILCWLPFHVGRYLFSKSFEPGSLEIAQI
SQYCNLVSFVLFYLSAAINPILYNIMSKKYRVAVFRLLGFEPFSQRKLSTLKDESSRAWT
ESSINT
|
|
|
BDBM50386953 |
---|
n/a |
---|
Name | BDBM50386953 |
Synonyms: | CHEMBL2048818 |
Type | Small organic molecule |
Emp. Form. | C26H34ClN3O4 |
Mol. Mass. | 488.019 |
SMILES | COc1ccc(OCC(=O)N2CCC3(CN(Cc4ccc(OCC(C)C)cc4Cl)C3)CC2)cn1 |
Structure |
|