Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50396852 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_862690 (CHEMBL2174238) |
---|
Ki | 2.2±n/a nM |
---|
Citation | Meyer, C; Schepmann, D; Yanagisawa, S; Yamaguchi, J; Dal Col, V; Laurini, E; Itami, K; Pricl, S; Wünsch, B Pd-catalyzed direct C-H bond functionalization of spirocyclics1 ligands: generation of a pharmacophore model and analysis of the reverse binding mode by docking into a 3D homology model of thes1 receptor. J Med Chem55:8047-65 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | OPRS1 | SGMR1_CAVPO | SIGMAR1 | Sigma 1-type opioid receptor | Sigma non-opioid intracellular receptor 1 | Sigma-1 receptor | Sigma1-receptor | Sigma1R | Sterol isomerase-like protein |
Type: | Protein |
Mol. Mass.: | 25307.17 |
Organism: | Cavia porcellus (Guinea pig) |
Description: | Q60492 |
Residue: | 223 |
Sequence: | MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSK
LIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP
|
|
|
BDBM50396852 |
---|
n/a |
---|
Name | BDBM50396852 |
Synonyms: | CHEMBL2170500 |
Type | Small organic molecule |
Emp. Form. | C26H29NO3S |
Mol. Mass. | 435.578 |
SMILES | COC1Cc2c(csc2-c2ccc(OC)cc2)C2(CCN(Cc3ccccc3)CC2)O1 |
Structure |
|