Reaction Details |
| Report a problem with these data |
Target | Bcl-2-related protein A1 |
---|
Ligand | BDBM50397586 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_862260 (CHEMBL2173037) |
---|
EC50 | 25500±n/a nM |
---|
Citation | Saugues, E; Debaud, AL; Anizon, F; Bonnefoy, N; Moreau, P Synthesis and biological activities of polyquinoline derivatives: new Bcl-2 family protein modulators. Eur J Med Chem57:112-25 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Bcl-2-related protein A1 |
---|
Name: | Bcl-2-related protein A1 |
Synonyms: | B2LA1_HUMAN | BCL2A1 | BCL2L5 | BFL1 | Bcl-2-like protein 5 | GRS | HBPA1 | Hemopoietic-specific early response protein | Protein BFL-1 | Protein GRS |
Type: | Apoptosis regulator protein |
Mol. Mass.: | 20130.01 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 175 |
Sequence: | MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVN
VVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISY
FVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQYC
|
|
|
BDBM50397586 |
---|
n/a |
---|
Name | BDBM50397586 |
Synonyms: | CHEMBL2171488 |
Type | Small organic molecule |
Emp. Form. | C27H29N3O |
Mol. Mass. | 411.5387 |
SMILES | CCOc1ccc2c(cc(cc2n1)-c1cc2ccccc2nc1N1CCCC1)C(C)C |
Structure |
|