| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Macrophage migration inhibitory factor |
|---|
| Ligand | BDBM50399046 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_878772 (CHEMBL2183712) |
|---|
| Ki | 270000±n/a nM |
|---|
| Citation |  Dahlgren, MK; Garcia, AB; Hare, AA; Tirado-Rives, J; Leng, L; Bucala, R; Jorgensen, WL Virtual screening and optimization yield low-nanomolar inhibitors of the tautomerase activity of Plasmodium falciparum macrophage migration inhibitory factor. J Med Chem55:10148-59 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Macrophage migration inhibitory factor |
|---|
| Name: | Macrophage migration inhibitory factor |
|---|
| Synonyms: | GIF | GLIF | Glycosylation-inhibiting factor | L-dopachrome isomerase | L-dopachrome tautomerase | MIF | MIF/CD74 (Macrophage migration inhibitory factor and HLA-DR antigens-associated invariant chain) | MIF_HUMAN | MMIF | Macrophage migration inhibitory factor | Macrophage migration inhibitory factor (MIF) | Phenylpyruvate tautomerase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 12478.18 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P14174 |
|---|
| Residue: | 115 |
|---|
| Sequence: | MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALC
SLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
|
|
|
|---|
| BDBM50399046 |
|---|
| n/a |
|---|
| Name | BDBM50399046 |
|---|
| Synonyms: | CHEMBL2178862 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H21NO3 |
|---|
| Mol. Mass. | 335.3963 |
|---|
| SMILES | COc1ccc(cc1)-c1cc(Oc2cc(C)cc(OC)c2)cc(C)n1 |
|---|
| Structure | 
|
|---|
Search and Browse
