Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM50138699 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_53614 |
---|
Ki | 18197±n/a nM |
---|
Citation | Selassie, CD; Fang, ZX; Li, RL; Hansch, C; Debnath, G; Klein, TE; Langridge, R; Kaufman, BT On the structure selectivity problem in drug design. A comparative study of benzylpyrimidine inhibition of vertebrate and bacterial dihydrofolate reductase via molecular graphics and quantitative structure-activity relationships. J Med Chem32:1895-905 (1989) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | 1.5.1.3 | DHFR | DYR_CHICK |
Type: | n/a |
Mol. Mass.: | 21652.69 |
Organism: | Gallus gallus (Chicken) |
Description: | n/a |
Residue: | 189 |
Sequence: | VRSLNSIVAVCQNMGIGKDGNLPWPPLRNEYKYFQRMTSTSHVEGKQNAVIMGKKTWFSI
PEKNRPLKDRINIVLSRELKEAPKGAHYLSKSLDDALALLDSPELKSKVDMVWIVGGTAV
YKAAMEKPINHRLFVTRILHEFESDTFFPEIDYKDFKLLTEYPGVPADIQEEDGIQYKFE
VYQKSVLAQ
|
|
|
BDBM50138699 |
---|
n/a |
---|
Name | BDBM50138699 |
Synonyms: | 5-(3-(benzyloxy)-4-methoxybenzyl)pyrimidine-2,4-diamine | 5-(3-Benzyloxy-4-methoxy-benzyl)-pyrimidine-2,4-diamine | CHEMBL291931 |
Type | Small organic molecule |
Emp. Form. | C19H20N4O2 |
Mol. Mass. | 336.3877 |
SMILES | COc1ccc(Cc2cnc(N)nc2N)cc1OCc1ccccc1 |
Structure |
|