| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM50406002 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_54726 (CHEMBL668339) |
|---|
| Ki | 107±n/a nM |
|---|
| Citation |  Selassie, CD; Li, RL; Poe, M; Hansch, C On the optimization of hydrophobic and hydrophilic substituent interactions of 2,4-diamino-5-(substituted-benzyl)pyrimidines with dihydrofolate reductase. J Med Chem34:46-54 (1991) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | 1.5.1.3 | Dihydrofolate reductase | folA | t0090 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 17976.56 |
|---|
| Organism: | Salmonella enterica subsp. enterica serovar Typhi |
|---|
| Description: | ChEMBL_13019 |
|---|
| Residue: | 159 |
|---|
| Sequence: | MISLIAALAVDRVIGMENAMPWNLPADLAWFKRNTLNKPVVMGRHTWESIGRPLPGRKNI
IISSQPGTDDRVQWVKSVDEAIAACGDAPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVE
GDTHFPDYEPDDWESVFSEFHDADAQNSHSYCFEILERR
|
|
|
|---|
| BDBM50406002 |
|---|
| n/a |
|---|
| Name | BDBM50406002 |
|---|
| Synonyms: | CHEMBL18912 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C13H14N6O3 |
|---|
| Mol. Mass. | 302.2887 |
|---|
| SMILES | CC(=O)Nc1ccc(Cc2cnc(N)nc2N)cc1[N+]([O-])=O |
|---|
| Structure | 
|
|---|
Search and Browse
