| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase type 1 |
|---|
| Ligand | BDBM50405984 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_54571 |
|---|
| Ki | 120±n/a nM |
|---|
| Citation |  Selassie, CD; Li, RL; Poe, M; Hansch, C On the optimization of hydrophobic and hydrophilic substituent interactions of 2,4-diamino-5-(substituted-benzyl)pyrimidines with dihydrofolate reductase. J Med Chem34:46-54 (1991) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase type 1 |
|---|
| Name: | Dihydrofolate reductase type 1 |
|---|
| Synonyms: | DYR1_ECOLX | dhfrI |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 17574.87 |
|---|
| Organism: | Escherichia coli |
|---|
| Description: | ChEMBL_54248 |
|---|
| Residue: | 157 |
|---|
| Sequence: | MKLSLMVAISKNGVIGNGPDIPWSAKGEQLLFKAITYNQWLLVGRKTFESMGALPNRKYA
VVTRSSFTSDNENVLIFPSIKDALTNLKKITDHVIVSGGGEIYKSLIDQVDTLHISTIDI
EPEGDVYFPEIPSNFRPVFTQDFASNINYSYQIWQKG
|
|
|
|---|
| BDBM50405984 |
|---|
| n/a |
|---|
| Name | BDBM50405984 |
|---|
| Synonyms: | CHEMBL434787 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C12H14N4O3S |
|---|
| Mol. Mass. | 294.33 |
|---|
| SMILES | CS(=O)(=O)Oc1cccc(Cc2cnc(N)nc2N)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
