Reaction Details |
| Report a problem with these data |
Target | Protein Tat |
---|
Ligand | BDBM50407477 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_199318 (CHEMBL805260) |
---|
IC50 | 2800±n/a nM |
---|
Citation | Michne, WF; Schroeder, JD; Bailey, TR; Neumann, HC; Cooke, D; Young, DC; Hughes, JV; Kingsley, SD; Ryan, KA; Putz, HS Keto/enol epoxy steroids as HIV-1 Tat inhibitors: structure-activity relationships and pharmacophore localization. J Med Chem38:3197-206 (1995) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Protein Tat |
---|
Name: | Protein Tat |
Synonyms: | Human immunodeficiency virus type 1 Tat protein | Protein Tat | TAT_HV112 | Transactivating regulatory protein | tat |
Type: | PROTEIN |
Mol. Mass.: | 9771.75 |
Organism: | Human immunodeficiency virus type 1 (isolate PCV12 group M subtype B)(HIV-1) |
Description: | ChEMBL_199318 |
Residue: | 86 |
Sequence: | MEPVDPRLEPWKHPGSQPKTACTNCYCKKCCFHCQVCFITKALGISYGRKKRRQRRRAPQ
GSQTHQVSLSKQPTSQSRGDPTGPKE
|
|
|
BDBM50407477 |
---|
n/a |
---|
Name | BDBM50407477 |
Synonyms: | CHEMBL109492 |
Type | Small organic molecule |
Emp. Form. | C18H21NO3 |
Mol. Mass. | 299.3642 |
SMILES | C[C@@]12CCCC[C@]11O[C@@H]1C(=O)C(C2)C(=O)Nc1ccccc1 |
Structure |
|