| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Acyl carrier protein, mitochondrial |
|---|
| Ligand | BDBM50411089 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_373476 (CHEMBL853536) |
|---|
| IC50 | 410±n/a nM |
|---|
| Citation |  Ichimaru, N; Abe, M; Murai, M; Senoh, M; Nishioka, T; Miyoshi, H Function of the alkyl side chains of Deltalac-acetogenins in the inhibitory effect on mitochondrial complex I (NADH-ubiquinone oxidoreductase). Bioorg Med Chem Lett16:3555-8 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Acyl carrier protein, mitochondrial |
|---|
| Name: | Acyl carrier protein, mitochondrial |
|---|
| Synonyms: | ACP | ACPM_BOVIN | CI-SDAP | NADH-ubiquinone oxidoreductase 9.6 kDa subunit | NDUFAB1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 17397.64 |
|---|
| Organism: | Bos taurus |
|---|
| Description: | ChEMBL_469770 |
|---|
| Residue: | 156 |
|---|
| Sequence: | MAVRVLCACVRRLPTAFAPLPRLPTLAAARPLSTTLFAAETRTRPGAPLPALVLAQVPGR
VTQLCRQYSDAPPLTLEGIKDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIM
AMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE
|
|
|
|---|
| BDBM50411089 |
|---|
| n/a |
|---|
| Name | BDBM50411089 |
|---|
| Synonyms: | CHEMBL211178 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H48O4 |
|---|
| Mol. Mass. | 412.6462 |
|---|
| SMILES | CCCCCCCCCCCCCC[C@@H](O)[C@H]1CC[C@@H](O1)[C@H]1CC[C@@H](O1)[C@@H](C)O |
|---|
| Structure | 
|
|---|
Search and Browse
