Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Acyl carrier protein, mitochondrial |
---|
Ligand | BDBM50411089 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_373476 (CHEMBL853536) |
---|
IC50 | 410±n/a nM |
---|
Citation | Ichimaru, N; Abe, M; Murai, M; Senoh, M; Nishioka, T; Miyoshi, H Function of the alkyl side chains of Deltalac-acetogenins in the inhibitory effect on mitochondrial complex I (NADH-ubiquinone oxidoreductase). Bioorg Med Chem Lett16:3555-8 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Acyl carrier protein, mitochondrial |
---|
Name: | Acyl carrier protein, mitochondrial |
Synonyms: | ACP | ACPM_BOVIN | CI-SDAP | NADH-ubiquinone oxidoreductase 9.6 kDa subunit | NDUFAB1 |
Type: | PROTEIN |
Mol. Mass.: | 17397.64 |
Organism: | Bos taurus |
Description: | ChEMBL_469770 |
Residue: | 156 |
Sequence: | MAVRVLCACVRRLPTAFAPLPRLPTLAAARPLSTTLFAAETRTRPGAPLPALVLAQVPGR
VTQLCRQYSDAPPLTLEGIKDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIM
AMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE
|
|
|
BDBM50411089 |
---|
n/a |
---|
Name | BDBM50411089 |
Synonyms: | CHEMBL211178 |
Type | Small organic molecule |
Emp. Form. | C25H48O4 |
Mol. Mass. | 412.6462 |
SMILES | CCCCCCCCCCCCCC[C@@H](O)[C@H]1CC[C@@H](O1)[C@H]1CC[C@@H](O1)[C@@H](C)O |
Structure |
|