Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Neuropeptide Y-Y2 receptor |
---|
Ligand | BDBM50417471 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_687957 (CHEMBL1291629) |
---|
Ki | 63.1±n/a nM |
---|
Citation | Lunniss, GE; Barnes, AA; Barton, N; Biagetti, M; Bianchi, F; Blowers, SM; Caberlotto, LL; Emmons, A; Holmes, IP; Montanari, D; Norris, R; Puckey, GV; Walters, DJ; Watson, SP; Willis, J The identification of a series of novel, soluble non-peptidic neuropeptide Y Y2 receptor antagonists. Bioorg Med Chem Lett20:7341-4 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Neuropeptide Y-Y2 receptor |
---|
Name: | Neuropeptide Y-Y2 receptor |
Synonyms: | n/a |
Type: | PROTEIN |
Mol. Mass.: | 8731.41 |
Organism: | Rattus norvegicus |
Description: | ChEMBL_687957 |
Residue: | 76 |
Sequence: | EYSLIEIIPDFEIVACTEKWPGEEKSVYGTVYSLSTLLILYVLPLGIISFSYTRIWSKLK
NHVSPGAASDHYHQRR
|
|
|
BDBM50417471 |
---|
n/a |
---|
Name | BDBM50417471 |
Synonyms: | CHEMBL1287953 |
Type | Small organic molecule |
Emp. Form. | C27H33ClF3N5O |
Mol. Mass. | 536.032 |
SMILES | CC(C)(C(=O)Nc1ccc(N2CCC3(CCN(CC4CC4)C3)CC2)c(Cl)c1)c1nccc(n1)C(F)(F)F |
Structure |
|