Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Free fatty acid receptor 1 |
---|
Ligand | BDBM50419160 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_770381 (CHEMBL1833690) |
---|
EC50 | 3890.45±n/a nM |
---|
Citation | Christiansen, E; Urban, C; Grundmann, M; Due-Hansen, ME; Hagesaether, E; Schmidt, J; Pardo, L; Ullrich, S; Kostenis, E; Kassack, M; Ulven, T Identification of a potent and selective free fatty acid receptor 1 (FFA1/GPR40) agonist with favorable physicochemical and in vitro ADME properties. J Med Chem54:6691-703 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Free fatty acid receptor 1 |
---|
Name: | Free fatty acid receptor 1 |
Synonyms: | FFAR1 | FFAR1_HUMAN | G-protein Coupled Receptor 40 | GPR40 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 31473.32 |
Organism: | Homo sapiens (Human) |
Description: | O14842 |
Residue: | 300 |
Sequence: | MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLP
LKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRP
CYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAG
PARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPY
NASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK
|
|
|
BDBM50419160 |
---|
n/a |
---|
Name | BDBM50419160 |
Synonyms: | CHEMBL1829154 |
Type | Small organic molecule |
Emp. Form. | C14H11NO2S |
Mol. Mass. | 257.308 |
SMILES | OC(=O)CCc1ccc(cc1)C#Cc1cncs1 |
Structure |
|