| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Free fatty acid receptor 1 |
|---|
| Ligand | BDBM50419160 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_770381 (CHEMBL1833690) |
|---|
| EC50 | 3890.45±n/a nM |
|---|
| Citation |  Christiansen, E; Urban, C; Grundmann, M; Due-Hansen, ME; Hagesaether, E; Schmidt, J; Pardo, L; Ullrich, S; Kostenis, E; Kassack, M; Ulven, T Identification of a potent and selective free fatty acid receptor 1 (FFA1/GPR40) agonist with favorable physicochemical and in vitro ADME properties. J Med Chem54:6691-703 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Free fatty acid receptor 1 |
|---|
| Name: | Free fatty acid receptor 1 |
|---|
| Synonyms: | FFAR1 | FFAR1_HUMAN | G-protein Coupled Receptor 40 | GPR40 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 31473.32 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | O14842 |
|---|
| Residue: | 300 |
|---|
| Sequence: | MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLP
LKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRP
CYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAG
PARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPY
NASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK
|
|
|
|---|
| BDBM50419160 |
|---|
| n/a |
|---|
| Name | BDBM50419160 |
|---|
| Synonyms: | CHEMBL1829154 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H11NO2S |
|---|
| Mol. Mass. | 257.308 |
|---|
| SMILES | OC(=O)CCc1ccc(cc1)C#Cc1cncs1 |
|---|
| Structure | 
|
|---|
Search and Browse
