| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 5-hydroxytryptamine receptor 1D |
|---|
| Ligand | BDBM50422023 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1964 (CHEMBL617569) |
|---|
| IC50 | 100±n/a nM |
|---|
| Citation |  Castro, JL; Baker, R; Guiblin, AR; Hobbs, SC; Jenkins, MR; Russell, MG; Beer, MS; Stanton, JA; Scholey, K; Hargreaves, RJ Synthesis and biological activity of 3-[2-(dimethylamino)ethyl]-5-[(1,1-dioxo-5-methyl-1,2,5-thiadiazolidin- 2-yl)-methyl]-1H-indole and analogues: agonists for the 5-HT1D receptor. J Med Chem37:3023-32 (1994) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 5-hydroxytryptamine receptor 1D |
|---|
| Name: | 5-hydroxytryptamine receptor 1D |
|---|
| Synonyms: | 5HT1D_PIG | HTR1D | Serotonin 1d (5-HT1d) receptor |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 32680.56 |
|---|
| Organism: | Sus scrofa |
|---|
| Description: | ChEMBL_1963 |
|---|
| Residue: | 291 |
|---|
| Sequence: | AMTDLLVSILVMPISIPYTITQTWSFGQLLCDIWLSSDITCCTASILHLCVIALDRYWAI
TDALEYSKRRTAGHAAAMIAIVWAISICISIPPLFWRQARAHEEISDCLVNTSQISYTIY
STCGAFYIPSLLLIILYGRIYRAARNRILNPPSLYGKRFTTAHLITGSAGSSLCSLNPSL
HEGHSHSAGSPLFFNHVKIKLADSVLERKRISAARERKATKTLGIILGAFIICWLPFFVA
SLVLPICRDSCWIHPALFDFFTWLGYLNSLINPIIYTVFNEEFRQAFQKVV
|
|
|
|---|
| BDBM50422023 |
|---|
| n/a |
|---|
| Name | BDBM50422023 |
|---|
| Synonyms: | CHEMBL318571 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H28N4O2S |
|---|
| Mol. Mass. | 364.506 |
|---|
| SMILES | CC(C)N1CCN(Cc2ccc3[nH]cc(CCN(C)C)c3c2)S1(=O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
