Reaction Details |
| Report a problem with these data |
Target | Mu-type opioid receptor |
---|
Ligand | BDBM50422792 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_334063 (CHEMBL861853) |
---|
IC50 | 5012±n/a nM |
---|
Citation | Middleton, DS; Maw, GN; Challenger, C; Jessiman, A; Johnson, PS; Million, WA; Nichols, CL; Price, JA; Trevethick, M Highly potent and selective zwitterionic agonists of the delta-opioid receptor. Part 1. Bioorg Med Chem Lett16:905-10 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Mu-type opioid receptor |
---|
Name: | Mu-type opioid receptor |
Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 11165.58 |
Organism: | GUINEA PIG |
Description: | P97266 |
Residue: | 98 |
Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
BDBM50422792 |
---|
n/a |
---|
Name | BDBM50422792 |
Synonyms: | CHEMBL202478 |
Type | Small organic molecule |
Emp. Form. | C32H39N3O3 |
Mol. Mass. | 513.6704 |
SMILES | COc1cccc(c1)[C@H](N1C[C@@H](C)N(Cc2ccccc2)C[C@@H]1C)c1ccc2CCN(CC(O)=O)Cc2c1 |
Structure |
|