Reaction Details |
| Report a problem with these data |
Target | Bcl-2-like protein 1 |
---|
Ligand | BDBM50424735 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_934322 (CHEMBL2320308) |
---|
Ki | >15000±n/a nM |
---|
Citation | Friberg, A; Vigil, D; Zhao, B; Daniels, RN; Burke, JP; Garcia-Barrantes, PM; Camper, D; Chauder, BA; Lee, T; Olejniczak, ET; Fesik, SW Discovery of potent myeloid cell leukemia 1 (Mcl-1) inhibitors using fragment-based methods and structure-based design. J Med Chem56:15-30 (2013) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Bcl-2-like protein 1 |
---|
Name: | Bcl-2-like protein 1 |
Synonyms: | Anti-apoptotic Bcl-2 protein | Apoptosis Regulator Bcl-xL | Apoptosis regulator Bcl-X | B2CL1_HUMAN | BCL2-like 1 isoform 1 | BCL2L | BCL2L1 | BCLX | Bcl-2-like protein 1 (Bcl-XL) | Bcl-X | Bcl-xL/Bcl-2-binding component 3 | Bcl2-L-1 | Bcl2-antagonist of cell death (BAD) |
Type: | Mitochondrion membrane; Single-pass membrane protein |
Mol. Mass.: | 26039.60 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 233 |
Sequence: | MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
|
|
|
BDBM50424735 |
---|
n/a |
---|
Name | BDBM50424735 |
Synonyms: | CHEMBL2314193 |
Type | Small organic molecule |
Emp. Form. | C20H20ClNO3 |
Mol. Mass. | 357.831 |
SMILES | Cc1cc(OCCCc2c([nH]c3ccccc23)C(O)=O)cc(C)c1Cl |
Structure |
|