| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Galectin-1 |
|---|
| Ligand | BDBM21533 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_936060 (CHEMBL2319302) |
|---|
| Kd | 70000±n/a nM |
|---|
| Citation |  van Hattum, H; Branderhorst, HM; Moret, EE; Nilsson, UJ; Leffler, H; Pieters, RJ Tuning the preference of thiodigalactoside- and lactosamine-based ligands to galectin-3 over galectin-1. J Med Chem56:1350-4 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Galectin-1 |
|---|
| Name: | Galectin-1 |
|---|
| Synonyms: | 14 kDa lectin | Galaptin | HPL | LEG1_HUMAN | LGALS1 | Lactose-binding lectin 1 | Lectin galactoside-binding soluble 1 | Putative MAPK-activating protein PM12 |
|---|
| Type: | beta galactoside-binding protein |
|---|
| Mol. Mass.: | 14713.53 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P09382 |
|---|
| Residue: | 135 |
|---|
| Sequence: | MACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIV
CNSKDGGAWGTEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINY
MAADGDFKIKCVAFD
|
|
|
|---|
| BDBM21533 |
|---|
| n/a |
|---|
| Name | BDBM21533 |
|---|
| Synonyms: | N-[(2R,3R,4R,5S,6R)-4-hydroxy-6-(hydroxymethyl)-2-methoxy-5-{[(2S,3R,4S,5R,6R)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy}oxan-3-yl]acetamide | Thioureido N-acetyllactosamine derivative, 17 |
|---|
| Type | n/a |
|---|
| Emp. Form. | C15H27NO11 |
|---|
| Mol. Mass. | 397.375 |
|---|
| SMILES | CO[C@@H]1O[C@H](CO)[C@@H](O[C@@H]2O[C@H](CO)[C@H](O)[C@H](O)[C@H]2O)[C@H](O)[C@H]1NC(C)=O |
|---|
| Structure | 
|
|---|
Search and Browse
