Reaction Details |
| Report a problem with these data |
Target | Galectin-1 |
---|
Ligand | BDBM50425520 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_936060 (CHEMBL2319302) |
---|
Kd | 49±n/a nM |
---|
Citation | van Hattum, H; Branderhorst, HM; Moret, EE; Nilsson, UJ; Leffler, H; Pieters, RJ Tuning the preference of thiodigalactoside- and lactosamine-based ligands to galectin-3 over galectin-1. J Med Chem56:1350-4 (2013) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Galectin-1 |
---|
Name: | Galectin-1 |
Synonyms: | 14 kDa lectin | Galaptin | HPL | LEG1_HUMAN | LGALS1 | Lactose-binding lectin 1 | Lectin galactoside-binding soluble 1 | Putative MAPK-activating protein PM12 |
Type: | beta galactoside-binding protein |
Mol. Mass.: | 14713.53 |
Organism: | Homo sapiens (Human) |
Description: | P09382 |
Residue: | 135 |
Sequence: | MACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIV
CNSKDGGAWGTEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINY
MAADGDFKIKCVAFD
|
|
|
BDBM50425520 |
---|
n/a |
---|
Name | BDBM50425520 |
Synonyms: | CHEMBL2313627 |
Type | Small organic molecule |
Emp. Form. | C28H32N6O8S |
Mol. Mass. | 612.654 |
SMILES | OC[C@H]1O[C@@H](S[C@@H]2O[C@H](CO)[C@H](O)[C@@H]([C@H]2O)n2cc(nn2)-c2ccccc2)[C@H](O)[C@H]([C@H]1O)n1cc(nn1)-c1ccccc1 |r| |
Structure |
|